2021-02-24RELPDBePDBePDBe2020-05-142021-02-242021-02-242021-02-24German Research Foundation (DFG)FOR2969GermanyAL amyloid fibril from a lambda 3 light chain in conformation ARadamaker LFandrich MRadamaker LBaur JHuhn SHaupt CHegenbart USchonland SBansal ASchmidt MFandrich MCryo-EM reveals structural breaks in a patient-derived amyloid fibril from systemic AL amyloidosis.Nat CommunUK12875875202133558536doi:10.1038/s41467-021-21126-22041-1723EMD-4452other EM volumelambda 1 cardiac light chain amyloid fibrilEMD-11031associated EM volumeAL amyloid fibril from a lambda 3 light chain in conformation A6z1oFULLOVERLAPAmyloid fibril of an antibody lambda 3 immunoglobulin light chainAmyloid fibril of an antibody lambda 3 immunoglobulin light chain01Extracted fibrils from the explanted heart of a systemic AL amyloidosis patientHomo sapiensHeartHeart musclelambda 3 immunoglobulin light chain fragment, residues 2-116HumanHeartheart muscle0.0094313036LEVOAVSVALGQTVRITCQGDSLRSYSASWYQQKPGQAPVLVIFRRFSGSSSGNTASLTITGAQAEDEADYYCNSRDSSANHQV
FGGGTKLTVhelicalfilament7.0H2ODistilled waterC-flat-1.2/1.3COPPER400CARBONHOLEYGLOW DISCHARGEOTHER40 mAETHANE95295FEI VITROBOT MARK IIIblot for 9s before plunging. Sample in pure water, pH not determinedFEI TITAN KRIOSFLOOD BEAMBRIGHT FIELDFIELD EMISSION GUN3002.7FEI TITAN KRIOS AUTOGRID HOLDERNITROGEN20GATAN K2 SUMMIT (4k x 4k)COUNTING383837101196440.01Motion-corrected and dose-weighted movie frames14.8-1.1C1FOURIER SPACE3.2FSC 0.143 CUT-OFFRELION2.1.011003Gctf1.06CTF was estimated from the non-dose-weighted micrographs194502manual particle picking helical start-end coordinatesInitial model generation in RELION, followed by a 3D classification of particles picked from only 9 micrographs to generate rough 3D model which was used as a referenceNOT APPLICABLEOTHERSecondary structure restraints and NCS were applied during refinementREAL-SPACE (WEIGHTED MAP SUM AT ATOM CENTERS)REAL73.24emd_11031_half_map_1.map.gz1IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES)
300
300300
0
00300300300312.0312.0312.090.090.090.0XYZ-0.0170960110.0471805370.00052971890.0028939491.041.041.04emd_11031_half_map_2.map.gz1IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES)